2.20 Rating by ClearWebStats
customtshirtscheap.com is 5 years 6 months 2 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, customtshirtscheap.com is SAFE to browse.
Get Custom Widget

Traffic Report of Customtshirtscheap

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
85
Siteadvisor Rating
View customtshirtscheap.com site advisor rating Not Applicable

Where is customtshirtscheap.com server located?

Hosted IP Address:

198.252.106.234 View other site hosted with customtshirtscheap.com

Hosted Country:

customtshirtscheap.com hosted country US customtshirtscheap.com hosted country

Location Latitude:

34.0522

Location Longitude:

-118.244

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View customtshirtscheap.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 9
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 10
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 198.252.106.234)

403: Access Forbidden

customtshirtscheap.com favicon - heylinkit.com

View customtshirtscheap.com Pagerank   customtshirtscheap.com alexa rank Not Applicable   customtshirtscheap.com website value $ 8.95

Melones Old Movies

customtshirtscheap.com favicon - melonesoldmovies.com

Free Download Classic Old Movies

View customtshirtscheap.com Pagerank   customtshirtscheap.com alexa rank Not Applicable   customtshirtscheap.com website value $ 8.95

Ebooks For Easy Life – Ebooks For Easy Life

customtshirtscheap.com favicon - ebooksforeasylife.com

View customtshirtscheap.com Pagerank   customtshirtscheap.com alexa rank Not Applicable   customtshirtscheap.com website value $ 8.95

Cinema World Movies

customtshirtscheap.com favicon - cinemaworldmovies.com

cinemaworldmovies.com is providing you free access to all the latest movies for free. You can get every movie here for free.

View customtshirtscheap.com Pagerank   customtshirtscheap.com alexa rank 409,402   customtshirtscheap.com website value $ 5,760.00

Home and Kitchen Appliances Review

customtshirtscheap.com favicon - homeandkitchenappliancesreview.com

Ultimate Guide to Buy Home and Kitchen Appliances - Reviews and Comparison

View customtshirtscheap.com Pagerank   customtshirtscheap.com alexa rank Not Applicable   customtshirtscheap.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
X-Powered-By: PHP/5.5.38
Content-Type: text/html; charset=UTF-8
Referrer-Policy: unsafe-url
x-frame-options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Link: ; rel=shortlink
Transfer-Encoding: chunked
Content-Encoding: br
Vary: Accept-Encoding
Date: Tue, 09 Oct 2018 19:06:25 GMT
Server: LiteSpeed
Connection: close

Domain Information for customtshirtscheap.com

Domain Registrar: NAMECHEAP INC. customtshirtscheap.com registrar info
Registration Date: 2018-10-04 5 years 6 months 2 weeks ago
Last Modified: 2018-10-04 5 years 6 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns13.hawkhost.com customtshirtscheap.com name server information 198.252.96.160 customtshirtscheap.com server is located in United States United States
ns14.hawkhost.com customtshirtscheap.com name server information 198.252.97.160 customtshirtscheap.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
customtshirtscheap.com A 14389 IP:198.252.106.234
customtshirtscheap.com NS 21599 Target:ns14.hawkhost.com
customtshirtscheap.com NS 21599 Target:ns13.hawkhost.com
customtshirtscheap.com SOA 21599 MNAME:ns13.hawkhost.com
RNAME:server.hawkhost.com
Serial:2018100404
Refresh:86400
Retry:7200
Expire:2419200
customtshirtscheap.com MX 14399 Target:customtshirtscheap.com
customtshirtscheap.com TXT 14399 TXT:v=spf1 +a +mx +ip4:198.252.106.85
+include:_spf.arandomserver.com ~all

Similarly Ranked Websites to Customtshirtscheap

Google

customtshirtscheap.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View customtshirtscheap.com Pagerank   Alexa rank for customtshirtscheap.com 1   website value of customtshirtscheap.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

customtshirtscheap.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View customtshirtscheap.com Pagerank   Alexa rank for customtshirtscheap.com 1   website value of customtshirtscheap.com $ 8,833,062,960.00

Gmail

customtshirtscheap.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View customtshirtscheap.com Pagerank   Alexa rank for customtshirtscheap.com 1   website value of customtshirtscheap.com $ 8,833,062,960.00

Android Apps on Google Play

customtshirtscheap.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View customtshirtscheap.com Pagerank   Alexa rank for customtshirtscheap.com 1   website value of customtshirtscheap.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

customtshirtscheap.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View customtshirtscheap.com Pagerank   Alexa rank for customtshirtscheap.com 1   website value of customtshirtscheap.com $ 8,833,062,960.00

Full WHOIS Lookup for customtshirtscheap.com

Domain Name: CUSTOMTSHIRTSCHEAP.COM
Registry Domain ID: 2317478586_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2018-10-04T13:55:16Z
Creation Date: 2018-10-04T10:09:37Z
Registry Expiry Date: 2019-10-04T10:09:37Z
Registrar: NameCheap Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS13.HAWKHOST.COM
Name Server: NS14.HAWKHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-10-09T19:06:32Z